DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enok and SAS2

DIOPT Version :9

Sequence 1:NP_001286823.1 Gene:enok / 37859 FlyBaseID:FBgn0034975 Length:2291 Species:Drosophila melanogaster
Sequence 2:NP_013846.1 Gene:SAS2 / 855157 SGDID:S000004734 Length:338 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:89/272 - (32%)
Similarity:143/272 - (52%) Gaps:27/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 IEKVNDVSLKSGQNTQSPKSIQIG-KWDIETWYSSP--FPQEYAR-------------------L 737
            |:|.....|....|.::.:.||.| .....|||.|.  |..|..|                   |
Yeast    33 IKKTQKEMLYGILNERNIRQIQFGLNKKFSTWYGSAVYFDPETKRLGCSETKGQLSSVSNSQYWL 97

  Fly   738 LKLFLCEFCLKYTKSRSVLDRHQNKCIWK-QPPGTEIFRQGNISVFEVDGNVNKIYCQNLCLLAK 801
            ..||:||:|.|||..::....|...|.:: :.||...::....::..|.|:..:::||.|||..|
Yeast    98 DTLFVCEYCFKYTDDQTRFVGHVASCPFQYRVPGKIKYKSPEYTIRRVKGSKYQLFCQCLCLFTK 162

  Fly   802 FFLDHKTLYYDVEPFLFYILTKNDQSGCHLVGYFSKEKHCTQKYNVSCILTMPQYQRQGYGRFLI 866
            .:||:|::|:.|:.:.|||:.:...:  ..:|:|||:....|:.|::|||..|.|||:|.|..||
Yeast   163 LYLDNKSMYFKVDHYEFYIVYETGST--KPMGFFSKDLVSYQQNNLACILIFPPYQRRGLGLLLI 225

  Fly   867 DFSYLLSREEGQLGTPEKPLSDLGRLSYFSYWKSVVLEYLYKH--RNYTKITFKDIAIKTGLAIS 929
            :|||.||:.||.:..||.|||..|.:.|..||..::..:|.:.  .:|.|:|.:|::|.||:.::
Yeast   226 EFSYKLSQLEGVISGPEVPLSPFGLIGYLKYWSQILCWHLIEGDLAHYDKVTLEDLSIVTGMRVN 290

  Fly   930 DIALAFELLNFI 941
            |:.|..:.||.|
Yeast   291 DVILTLKHLNCI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enokNP_001286823.1 H15 95..152 CDD:294056
PHD_SF 183..>215 CDD:304600
PHD 248..292 CDD:214584
NAT_SF 713..989 CDD:302625 85/254 (33%)
MOZ_SAS 768..947 CDD:280097 64/176 (36%)
Ehrlichia_rpt <1150..>1539 CDD:118064
SAS2NP_013846.1 SAS2 <31..338 CDD:227360 89/272 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.