DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enok and kat7a

DIOPT Version :9

Sequence 1:NP_001286823.1 Gene:enok / 37859 FlyBaseID:FBgn0034975 Length:2291 Species:Drosophila melanogaster
Sequence 2:NP_001070052.1 Gene:kat7a / 767644 ZFINID:ZDB-GENE-060929-168 Length:128 Species:Danio rerio


Alignment Length:119 Identity:29/119 - (24%)
Similarity:48/119 - (40%) Gaps:21/119 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 RKRTFSDLSSTSSSSESEDEDDEDDDRNRNGDDNDQDES-------TSSDSCTSSSSDSDSSESS 454
            |||      :..||||.    .||.|.:....|:.:.|:       .:..|...|.|..|:|...
Zfish     4 RKR------NAGSSSEG----TEDSDFSAEHTDSSESEAHVVRNTRLTRSSLRLSRSSQDASPVR 58

  Fly   455 SDTSEWDDEYDEEEDYDTDRST-IREKNVFESGKQSCAKLSTGDGLGSPQNNEL 507
            :.|:...:|.   .:|.|.|.| .:::....|.|:...:.|...|..:.|:.|:
Zfish    59 NPTAPVSEEV---VNYSTRRVTRSQQQGATVSPKKYPLRQSRSSGSDTEQHGEI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enokNP_001286823.1 H15 95..152 CDD:294056
PHD_SF 183..>215 CDD:304600
PHD 248..292 CDD:214584
NAT_SF 713..989 CDD:302625
MOZ_SAS 768..947 CDD:280097
Ehrlichia_rpt <1150..>1539 CDD:118064
kat7aNP_001070052.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8341
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103737
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.