DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment enok and Samd1

DIOPT Version :9

Sequence 1:	NP_001286823.1	Gene:	enok / 37859	FlyBaseID:	FBgn0034975	Length:	2291	Species:	Drosophila melanogaster
Sequence 2:	NP_001074884.1	Gene:	Samd1 / 666704	MGIID:	2142433	Length:	519	Species:	Mus musculus

Alignment Length:	64	Identity:	23/64 - (35%)
Similarity:	39/64 - (60%)	Gaps:	0/64 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 WNQWILEAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAVESGAVIKVYNKGLHSYK 77
            :.:|||:.|..:||:|.||.::|||:.:...|....:....:|||.::..||::|..||..||:
Mouse    31 YQEWILDTIDSLRSRKARPDLERICRMVRRRHGPEPERTRAELEKLIQQRAVLRVSYKGSISYR 94

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
enok	NP_001286823.1	H15	95..152	CDD:294056
		PHD_SF	183..>215	CDD:304600
		PHD	248..292	CDD:214584
		NAT_SF	713..989	CDD:302625
		MOZ_SAS	768..947	CDD:280097
		Ehrlichia_rpt	<1150..>1539	CDD:118064
Samd1	NP_001074884.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	87..232		4/8 (50%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	261..381
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	417..439
		SAM_Atherin-like	440..508	CDD:188982
		SAM	440..506	CDD:197735
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5027
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900