DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enok and CG1894

DIOPT Version :9

Sequence 1:NP_001286823.1 Gene:enok / 37859 FlyBaseID:FBgn0034975 Length:2291 Species:Drosophila melanogaster
Sequence 2:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster


Alignment Length:394 Identity:131/394 - (33%)
Similarity:199/394 - (50%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 EAGKSYEKCEDDIPYLTEETVMKVQLLEEIERSRET-HSQADGKREMN------NDEDAPGESTK 657
            |.|||..:.:..:....:||........|.:|...| ..|.:|.:|.|      .:..:..:..:
  Fly    55 EMGKSQLQNDSSLQKNIQETKTITGSCIEAQRIGATPKKQLEGVKEPNMISLLHTNASSNVDDRQ 119

  Fly   658 RANPFENQPLPPGVTATDVELYQEVLHKAVVQMSNNHIEKVNDVSLKSGQNTQSPKSIQIGKWDI 722
            |....:|:       .:||:..:|   .|.|::..| ||||                 |.|:::|
  Fly   120 RQETIDNE-------KSDVQKEKE---DAKVKVIRN-IEKV-----------------QFGRYEI 156

  Fly   723 ETWYSSPFPQEYARLLKLFLCEFCLKYTKSRSVLDRHQNKCIWKQPPGTEIFRQGNISVFEVDGN 787
            ||..|||:|....:...:::|||||||...|.....|...|..:.|||:.::|:.||.::||||:
  Fly   157 ETTSSSPYPVINDKATTIYVCEFCLKYMCLRKSYSYHLYDCKKRCPPGSLLYRKDNIYIYEVDGH 221

  Fly   788 VNKIYCQNLCLLAKFFLDHKTLYYDVEPFLFYILTKNDQSGCHLVGYFSKEKHCTQKYNVSCILT 852
            ..::|||.|||::|.||::|.:.|....||||||...|:.|.|..|||::|| .....|::|||.
  Fly   222 KEQLYCQCLCLMSKLFLENKKILYSSSSFLFYILCLKDKDGEHFAGYFAREK-TMLNINLNCILV 285

  Fly   853 MPQYQRQGYGRFLIDFSYLLSREEGQLGTPEKPLSDLGRLSYFSYWKSVVLEYLYKHRNYTKITF 917
            :|.|.|:|||:.|||.||.:||.|..:|.|:||||.:.||.|.|||..::|..|..|.:...:|.
  Fly   286 LPPYMRKGYGKLLIDLSYEISRREACIGGPKKPLSKVARLCYLSYWGHILLNLLRHHSSPDLVTI 350

  Fly   918 KDIAIKTGLAISDIALAFELLNFIKLRKNDGDIRYQINVKIEWKKVLAHHNKMANSKTRIIIEPD 982
            ::::..||....||....|.:...|..|.|..:.|..:..||.::.||..     .|.|:.|..:
  Fly   351 EELSKATGFREEDIISTLEFMGMTKYYKVDHIMFYTTSSIIEDRRGLAQF-----KKPRLTIHRN 410

  Fly   983 CLRW 986
            .|.|
  Fly   411 RLSW 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enokNP_001286823.1 H15 95..152 CDD:294056
PHD_SF 183..>215 CDD:304600
PHD 248..292 CDD:214584
NAT_SF 713..989 CDD:302625 106/274 (39%)
MOZ_SAS 768..947 CDD:280097 76/178 (43%)
Ehrlichia_rpt <1150..>1539 CDD:118064
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 109/286 (38%)
MOZ_SAS 202..378 CDD:280097 75/176 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10615
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.