DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enok and tth

DIOPT Version :9

Sequence 1:NP_001286823.1 Gene:enok / 37859 FlyBaseID:FBgn0034975 Length:2291 Species:Drosophila melanogaster
Sequence 2:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster


Alignment Length:358 Identity:62/358 - (17%)
Similarity:113/358 - (31%) Gaps:124/358 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 YRCKTCSKQGFDTPKL-----VKKDNSRIKMEAERMTPSY-----------KYASNKRQSIKK-- 333
            :..:.||::....|.|     |.:::|::.::..:..|.:           ::..::||.:.|  
  Fly    37 FNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQGQIYTYPAARWRKSRRQYLSKMY 101

  Fly   334 ---------------------------------------DGNIESPSTSKLCVYNDGNGQRRKVP 359
                                                   ..::.|.|:..|.:...|..    .|
  Fly   102 SRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGSMPGSNSLASSSSLTLNMLTGGGA----AP 162

  Fly   360 ASLSSRKMNHSEDQFEFPSKQKRSQILQGGYLASQETRKRTFSDLSSTSSSSESEDEDDEDDDRN 424
            |.|.|.   ||:...:|           .|..:.:|         ||:..::..:..|.:|..:.
  Fly   163 AVLGSL---HSDTAHDF-----------NGAFSLEE---------SSSLGAAGGDTSDSKDSQQQ 204

  Fly   425 RNGDDNDQDESTSSDSCTS-------SSSDSDSSESSSDTSEWDDEYDEEEDYDTDRSTIREKNV 482
            ::.....|.::...:....       ..:|.||.|...  |..|||||.:..|...:   |.|. 
  Fly   205 QHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPK--SPADDEYDYDPRYGNKK---RRKR- 263

  Fly   483 FESGKQSCAKLSTGDGLGSPQNNELGSENWGFAAVAKNPIDIFVKSKHNSNVKGIGYSKPAASTF 547
             ..||:.......|.|.|:.     |..|.|.::.::.                  .|..|.|..
  Fly   264 -RPGKRGGDSGGGGGGGGAG-----GGGNSGGSSSSRR------------------RSAAARSRI 304

  Fly   548 ATSPAA-NRVQKSTPVASSTPEKNSAPI--GGM 577
            .|:.|| :...::.....|.|..|..||  ||:
  Fly   305 TTTDAALDASLEAIESGESVPGSNGGPISSGGI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enokNP_001286823.1 H15 95..152 CDD:294056
PHD_SF 183..>215 CDD:304600
PHD 248..292 CDD:214584 0/4 (0%)
NAT_SF 713..989 CDD:302625
MOZ_SAS 768..947 CDD:280097
Ehrlichia_rpt <1150..>1539 CDD:118064
tthNP_001285216.1 Requiem_N 24..94 CDD:290758 7/56 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.