DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gek and DCLK3

DIOPT Version :9

Sequence 1:NP_523837.2 Gene:gek / 37858 FlyBaseID:FBgn0023081 Length:1637 Species:Drosophila melanogaster
Sequence 2:NP_001381601.1 Gene:DCLK3 / 85443 HGNCID:19005 Length:817 Species:Homo sapiens


Alignment Length:406 Identity:103/406 - (25%)
Similarity:166/406 - (40%) Gaps:105/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LRREKG-VSDFLKLSKPFVHIVRKLRLSRDD---------------------------------- 99
            |||.:| ..:..|..||.:...|::.| |||                                  
Human   456 LRRTRGEEKEAEKEKKPCMSGGRRMTL-RDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAA 519

  Fly   100 -----FDILKIIGRGAFGEVCVVQMISTEKVYAMKILNKWEMLKRAETACFREERDVLVFGDRQW 159
                 ::..::||.|.|..|...:...|.:.|||||::| ..||..|...   :.::|:......
Human   520 NVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDK-SRLKGKEDMV---DSEILIIQSLSH 580

  Fly   160 --ITNLHYAFQDNINLYLVMDYYCGGDLLTLLSKFEDKLPEDMAKFYITEMILAINSIHQIRYVH 222
              |..||..::.::.:||:::|..||||...:.: ..|.||..|...|.::..|:..:|....||
Human   581 PNIVKLHEVYETDMEIYLILEYVQGGDLFDAIIE-SVKFPEPDAALMIMDLCKALVHMHDKSIVH 644

  Fly   223 RDIKPDNVLL----DKRGHVRLADFGSCLRLDKDGTVQSNVAVGTPDYISPEILRAMEDGKGRYG 283
            ||:||:|:|:    ||...::|||||    |.|..........|||.|::||||    ..|| ||
Human   645 RDLKPENLLVQRNEDKSTTLKLADFG----LAKHVVRPIFTVCGTPTYVAPEIL----SEKG-YG 700

  Fly   284 TECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHQNCFNLPSQETLNY------KVSETSQD 342
            .|.|.|:.||.:|.:|.|..||.:..        .:....||:.......:      .:|:.::|
Human   701 LEVDMWAAGVILYILLCGFPPFRSPE--------RDQDELFNIIQLGHFEFLPPYWDNISDAAKD 757

  Fly   343 LLCKLICI-PENRLGQNGIQDFMDHPWFVGIDWKNIRQGPAPYVPEVSSPTDTSNFDVDDNDVRL 406
            |:.:|:.: |:.|...:.:   :.|||.                 |.:..|:|         |:.
Human   758 LVSRLLVVDPKKRYTAHQV---LQHPWI-----------------ETAGKTNT---------VKR 793

  Fly   407 TDSIPPSANPAFSGFH 422
            ...:.||:...|...|
Human   794 QKQVSPSSEGHFRSQH 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gekNP_523837.2 STKc_DMPK_like 98..430 CDD:270748 93/377 (25%)
S_TKc 100..369 CDD:214567 82/281 (29%)
KELK 478..556 CDD:292424
CEP63 492..749 CDD:293650
CEP63 652..880 CDD:293650
C1_1 990..1040 CDD:278556
PH_MRCK 1049..1182 CDD:269949
CNH 1211..1486 CDD:279162
CRIB 1544..1580 CDD:238077
DCLK3NP_001381601.1 DCX_DCLK3 93..177 CDD:340528
STKc_DCKL3 524..781 CDD:271087 81/281 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.