DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gek and MKNK2

DIOPT Version :9

Sequence 1:NP_523837.2 Gene:gek / 37858 FlyBaseID:FBgn0023081 Length:1637 Species:Drosophila melanogaster
Sequence 2:NP_951009.1 Gene:MKNK2 / 2872 HGNCID:7111 Length:465 Species:Homo sapiens


Alignment Length:526 Identity:119/526 - (22%)
Similarity:203/526 - (38%) Gaps:137/526 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QKWAAE---FGEDTEG-HQFSLDYLLDTFIVLYDECSNSSLRREKGVSDF---------LKLSKP 85
            ||..||   |....:| :.|.|.:.||              :.:.|.|||         :..|:|
Human     3 QKKPAELQGFHRSFKGQNPFELAFSLD--------------QPDHGDSDFGLQCSARPDMPASQP 53

  Fly    86 FVHI--------VRKLRLSRDDF-----DILK----IIGRGAFGEVCVVQMISTEKVYAMKILNK 133
             :.|        .:|...:.|.|     |:.:    ::|.||...|.....:.|.:.||:||:.|
Human    54 -IDIPDAKKRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEK 117

  Fly   134 WEMLKRAETACFREERDVLVFGDRQWITNLHYAFQDNINLYLVMDYYCGGDLLTLLSKFEDKLPE 198
            .....|:..  |||...:......:.:..|...|::....|||.:...||.:|:.:.| .....|
Human   118 QPGHIRSRV--FREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHK-RRHFNE 179

  Fly   199 DMAKFYITEMILAINSIHQIRYVHRDIKPDNVLLDKRGH---VRLADF--GSCLRLDKD----GT 254
            ..|...:.::..|::.:|.....|||:||:|:|.:....   |::.||  ||.::|:.|    .|
Human   180 LEASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCSPIST 244

  Fly   255 VQSNVAVGTPDYISPEILRAMEDGKGRYGTECDWWSLGVCMYEMLYGETPFYA------------ 307
            .:.....|:.:|::||::.|..:....|...||.|||||.:|.:|.|..||..            
Human   245 PELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCGSDCGWDRGE 309

  Fly   308 ----------ESLVETYGKIMNHQNCFNLPSQETLNYKVSETSQDLLCKLIC-IPENRLGQNGIQ 361
                      ||:.|  ||       :..|.::..:  :|..::||:.||:. ..:.||....: 
Human   310 ACPACQNMLFESIQE--GK-------YEFPDKDWAH--ISCAAKDLISKLLVRDAKQRLSAAQV- 362

  Fly   362 DFMDHPWFVGIDWKNIRQGPAPYVPEVSS-PTDTSNFDVDDNDVRLTDSIPPSANPAFSGFHLPF 425
              :.|||..|...:|..  |.|.|.:.:| ..|.::|..:                        .
Human   363 --LQHPWVQGCAPENTL--PTPMVLQRNSCAKDLTSFAAE------------------------A 399

  Fly   426 IGFTFSLTSSSTLDSKKNQSSGFGDDTLDTISSPQLAILPSNNSETPVDSVQLKALNDQLAALKQ 490
            |.....|..... |..:.:::|.|...|...:|..|.:.|.:.|:               .|.::
Human   400 IAMNRQLAQHDE-DLAEEEAAGQGQPVLVRATSRCLQLSPPSQSK---------------LAQRR 448

  Fly   491 EKAELS 496
            ::|.||
Human   449 QRASLS 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gekNP_523837.2 STKc_DMPK_like 98..430 CDD:270748 88/373 (24%)
S_TKc 100..369 CDD:214567 77/309 (25%)
KELK 478..556 CDD:292424 4/19 (21%)
CEP63 492..749 CDD:293650 3/5 (60%)
CEP63 652..880 CDD:293650
C1_1 990..1040 CDD:278556
PH_MRCK 1049..1182 CDD:269949
CNH 1211..1486 CDD:279162
CRIB 1544..1580 CDD:238077
MKNK2NP_951009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..72 11/63 (17%)
Nuclear localization signal 60..66 0/5 (0%)
STKc_Mnk2 81..368 CDD:271075 76/303 (25%)
S_TKc 83..368 CDD:214567 75/301 (25%)
Staurosporine binding 160..162 0/1 (0%)
MAP kinase binding. /evidence=ECO:0000250 444..448 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.