DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gek and DMPK

DIOPT Version :9

Sequence 1:NP_523837.2 Gene:gek / 37858 FlyBaseID:FBgn0023081 Length:1637 Species:Drosophila melanogaster
Sequence 2:NP_001275693.1 Gene:DMPK / 1760 HGNCID:2933 Length:655 Species:Homo sapiens


Alignment Length:567 Identity:242/567 - (42%)
Similarity:341/567 - (60%) Gaps:87/567 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SKPFVHIVRKLRLSRDDFDILKIIGRGAFGEVCVVQMISTEKVYAMKILNKWEMLKRAETACFRE 147
            ::|.|..::::||.||||:|||:||||||.||.||:|..|.:||||||:|||:||||.|.:||||
Human    80 AEPIVVRLKEVRLQRDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFRE 144

  Fly   148 ERDVLVFGDRQWITNLHYAFQDNINLYLVMDYYCGGDLLTLLSKFEDKLPEDMAKFYITEMILAI 212
            ||||||.|||:|||.||:||||...|||||:||.|||||||||||.:::|.:||:||:.|:::||
Human   145 ERDVLVNGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAI 209

  Fly   213 NSIHQIRYVHRDIKPDNVLLDKRGHVRLADFGSCLRLDKDGTVQSNVAVGTPDYISPEILRAM-- 275
            :|:|::.||||||||||:|||:.||:|||||||||:|..||||:|.||||||||:|||||:|:  
Human   210 DSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAVGG 274

  Fly   276 EDGKGRYGTECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHQNCFNLPSQETLNYKVSETS 340
            ..|.|.||.|||||:|||..|||.||:|||||:|..||||||::::...:||   .::..|.|.:
Human   275 GPGTGSYGPECDWWALGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLP---LVDEGVPEEA 336

  Fly   341 QDLLCKLICIPENRLGQNGIQDFMDHPWFVGIDWKNIRQGPAPYVPEVSSPTDTSNFD-VDDNDV 404
            :|.:.:|:|.||.|||:.|..||..||:|.|:||..:|....|:.|:....|||.||| |:|...
Human   337 RDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVEDGLT 401

  Fly   405 RLT----DSIPPSANPAFSGFHLPFIGFTFSLTSSSTLDSKKNQSSGFGDDTLDTISSPQLAILP 465
            .:.    :::......|..|.||||:|:::|  ..:..||:              :..|      
Human   402 AMVSGGGETLSDIREGAPLGVHLPFVGYSYS--CMALRDSE--------------VPGP------ 444

  Fly   466 SNNSETPVDSVQLKALNDQLAALKQEKAELSKQHNEVFERLKTQDSELQDAISQRNIAMMEYSEV 530
                 ||::....:.|...:.|...|.:            :..||...:.|:.....|....:||
Human   445 -----TPMELEAEQLLEPHVQAPSLEPS------------VSPQDETAEVAVPAAVPAAEAEAEV 492

  Fly   531 T-----EKLSELRNQKQKLSRQVRDKEEELDGAMQKNDSLRNELRKSDKTRRELELHIEDAVIEA 590
            |     |.|.|....:|.|||       |::.....|.:..::||:::...|:||.|:       
Human   493 TLRELQEALEEEVLTRQSLSR-------EMEAIRTDNQNFASQLREAEARNRDLEAHV------- 543

  Fly   591 AKEKKLREHAEDCCRQLQ--MEL--RKGSSSVETTMPLSISSEMSSY 633
                          ||||  |||  .:|:::| |.:|...:::..|:
Human   544 --------------RQLQERMELLQAEGATAV-TGVPSPRATDPPSH 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gekNP_523837.2 STKc_DMPK_like 98..430 CDD:270748 194/338 (57%)
S_TKc 100..369 CDD:214567 170/270 (63%)
KELK 478..556 CDD:292424 18/82 (22%)
CEP63 492..749 CDD:293650 34/151 (23%)
CEP63 652..880 CDD:293650
C1_1 990..1040 CDD:278556
PH_MRCK 1049..1182 CDD:269949
CNH 1211..1486 CDD:279162
CRIB 1544..1580 CDD:238077
DMPKNP_001275693.1 STKc_DMPK_like 95..432 CDD:270748 194/339 (57%)
S_TKc 97..365 CDD:214567 170/270 (63%)
DMPK_coil 496..556 CDD:117396 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117302at33208
OrthoFinder 1 1.000 - - FOG0001346
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.