powered by:
Protein Alignment gek and LOC101884327
DIOPT Version :9
Sequence 1: | NP_523837.2 |
Gene: | gek / 37858 |
FlyBaseID: | FBgn0023081 |
Length: | 1637 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009303016.1 |
Gene: | LOC101884327 / 101884327 |
-ID: | - |
Length: | 114 |
Species: | Danio rerio |
Alignment Length: | 50 |
Identity: | 15/50 - (30%) |
Similarity: | 28/50 - (56%) |
Gaps: | 6/50 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 1156 LMLADNESEKSKWVIALGELHRILKRNSLPNTAIFKV----NEILDNTLS 1201
|:||::..|:.|||..| |.|:.::.|:.:::...: :|....|||
Zfish 8 LLLANSTEEQKKWVSRL--LKRVPRKPSIAHSSSIAISAAPSEATPTTLS 55
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D759391at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.