Sequence 1: | NP_523837.2 | Gene: | gek / 37858 | FlyBaseID: | FBgn0023081 | Length: | 1637 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021326563.1 | Gene: | LOC101883269 / 101883269 | -ID: | - | Length: | 206 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 98/198 - (49%) |
---|---|---|---|
Similarity: | 143/198 - (72%) | Gaps: | 7/198 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 MDYYCGGDLLTLLSKFEDKLPEDMAKFYITEMILAINSIHQIRYVHRDIKPDNVLLDKRGHVRLA 241
Fly 242 DFGSCLRLDKDGTVQSNVAVGTPDYISPEILRAMEDGKGRYGTECDWWSLGVCMYEMLYGETPFY 306
Fly 307 AESLVETYGKIMNHQNCFNLPSQETLNYKVSETSQDLLCKLICIPENRLGQNGIQDFMDHPWFVG 371
Fly 372 IDW 374 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gek | NP_523837.2 | STKc_DMPK_like | 98..430 | CDD:270748 | 98/198 (49%) |
S_TKc | 100..369 | CDD:214567 | 96/191 (50%) | ||
KELK | 478..556 | CDD:292424 | |||
CEP63 | 492..749 | CDD:293650 | |||
CEP63 | 652..880 | CDD:293650 | |||
C1_1 | 990..1040 | CDD:278556 | |||
PH_MRCK | 1049..1182 | CDD:269949 | |||
CNH | 1211..1486 | CDD:279162 | |||
CRIB | 1544..1580 | CDD:238077 | |||
LOC101883269 | XP_021326563.1 | PKc_like | <1..200 | CDD:328722 | 98/198 (49%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D759391at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |