DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gek and stk38b

DIOPT Version :9

Sequence 1:NP_523837.2 Gene:gek / 37858 FlyBaseID:FBgn0023081 Length:1637 Species:Drosophila melanogaster
Sequence 2:XP_017208958.1 Gene:stk38b / 100332206 ZFINID:ZDB-GENE-081031-2 Length:469 Species:Danio rerio


Alignment Length:484 Identity:180/484 - (37%)
Similarity:261/484 - (53%) Gaps:82/484 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SDITTGSCKKRLTFLKCILSDTTSDQKWAAEFGEDTEGHQFSLDYLLDTFIVLYDECSNSSLRRE 73
            |.:.:...|:|:|..|..|.:..|:   .....|:.|..|..|:.::|. ..|.||  ...:||.
Zfish     9 SSLMSNHTKERVTMAKVTLENFYSN---LITQHEEREMRQQKLEKVMDE-EGLPDE--EKRVRRS 67

  Fly    74 KGV---SDFLKLSKPFVHIVRKLRLSRDDFDILKIIGRGAFGEVCVVQMISTEKVYAMKILNKWE 135
            :..   ::||:|        ::.||..|||:.||:|||||||||.:||...|..|||||||.|.:
Zfish    68 QHARKETEFLRL--------KRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKAD 124

  Fly   136 MLKRAETACFREERDVLVFGDRQWITNLHYAFQDNINLYLVMDYYCGGDLLTLLSKFEDKLPEDM 200
            ||::.:.|..|.|||:||..|..|:..:.|:|||.:||||:|::..|||::|||.| :|.|.|:.
Zfish   125 MLQKEQVAHIRAERDILVQADSLWVVKMFYSFQDKLNLYLLMEFLPGGDMMTLLMK-KDTLTEEE 188

  Fly   201 AKFYITEMILAINSIHQIRYVHRDIKPDNVLLDKRGHVRLADFGSCLRLDKDGTV---------Q 256
            .:||:.|.:|||:.|||:.::||||||||:|||.:|||:|:|||.|..|.|....         |
Zfish   189 TQFYVAETVLAIDFIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSQ 253

  Fly   257 SN-------------------------VAVGTPDYISPEILRAMEDGKGRYGTECDWWSLGVCMY 296
            ||                         ..|||||||:||:.  |:.|   |...||||||||.||
Zfish   254 SNDLTFQHMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVF--MQTG---YNKLCDWWSLGVIMY 313

  Fly   297 EMLYGETPFYAESLVETYGKIMNHQNCFNLPSQETLNYKVSETSQDLLCKLICIPENRLGQNGIQ 361
            |||.|..||.:|:..|||.|:|..:.....|.:    ..:||.:::|:.:..|..::|:|..|:.
Zfish   314 EMLIGYPPFCSETPQETYKKVMGWKETLVFPPE----VPISERAKELILRFCCEADHRIGAGGVD 374

  Fly   362 DFMDHPWFVGIDWKNIRQGPAPYVPEVSSPTDTSNFD-VDDNDVRLTDSIPPSANPAFSGFHLP- 424
            |...:.:|.|:|:.:||:.||....|:.|..|||||| ..|:|:     :.|: :|.....|.| 
Zfish   375 DIKRNAFFEGVDYDHIRERPAAITIEIKSIDDTSNFDEFPDSDI-----LQPT-SPVVVSNHHPE 433

  Fly   425 ---------FIGFTF----SLTSSSTLDS 440
                     ||.:|:    .||:...:.|
Zfish   434 SDYKNKDWVFINYTYKRFEGLTARGAIPS 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gekNP_523837.2 STKc_DMPK_like 98..430 CDD:270748 154/376 (41%)
S_TKc 100..369 CDD:214567 129/302 (43%)
KELK 478..556 CDD:292424
CEP63 492..749 CDD:293650
CEP63 652..880 CDD:293650
C1_1 990..1040 CDD:278556
PH_MRCK 1049..1182 CDD:269949
CNH 1211..1486 CDD:279162
CRIB 1544..1580 CDD:238077
stk38bXP_017208958.1 PKc_like 87..465 CDD:304357 158/392 (40%)
S_TKc 89..382 CDD:214567 129/302 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.