DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snama and si:dkey-27d5.13

DIOPT Version :10

Sequence 1:NP_611884.1 Gene:snama / 37857 FlyBaseID:FBgn0086129 Length:1231 Species:Drosophila melanogaster
Sequence 2:XP_021335438.2 Gene:si:dkey-27d5.13 / 108191590 ZFINID:ZDB-GENE-141216-36 Length:174 Species:Danio rerio


Alignment Length:148 Identity:53/148 - (35%)
Similarity:91/148 - (61%) Gaps:33/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VHYKFKSTLNFDTITFDGLHISVGDLKREIVQQKRLGKIIDF-DLQITNAQSKEEYKDDGFLIPK 66
            |||:|:|.|.:|::.|:||:|:.|:|||:|::::||    .| .|:|:.||:.|||.||..||||
Zfish     4 VHYRFQSRLTYDSLQFEGLNITAGELKRQIMRRERL----KFCQLKISKAQTDEEYTDDDALIPK 64

  Fly    67 NTTLIISRIP-----------IAHPTKKGWEPPAAENAFSAAPA--------KQDNFNMDLSKMQ 112
            ||::||.|:|           :.|..:     |:|:::.:...:        |.:|    |::.:
Zfish    65 NTSVIIRRVPAAGLKSSNRRFVGHQAE-----PSAKSSQTGDSSLLSLEQLLKTEN----LAEAK 120

  Fly   113 GTEEDKIQAMMMQSTVDY 130
            .:||||::|:|.||::.|
Zfish   121 ASEEDKLKAVMYQSSLCY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snamaNP_611884.1 COG5222 3..315 CDD:227547 53/148 (36%)
PTZ00449 <560..>778 CDD:185628
PRK12678 <1031..>1121 CDD:237171
si:dkey-27d5.13XP_021335438.2 DWNN 4..74 CDD:462603 37/73 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.