DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snama and LOC100536005

DIOPT Version :9

Sequence 1:NP_611884.1 Gene:snama / 37857 FlyBaseID:FBgn0086129 Length:1231 Species:Drosophila melanogaster
Sequence 2:XP_009302385.1 Gene:LOC100536005 / 100536005 -ID:- Length:215 Species:Danio rerio


Alignment Length:221 Identity:62/221 - (28%)
Similarity:97/221 - (43%) Gaps:85/221 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VHYKFKSTLNFDTITFDGLHISVGDLKREIVQQKRLGKIIDFDLQITNAQSKEEYKDDGFLIPKN 67
            |||:|:|.|.:|::.|:||:||.|:|||:|::.||| |..  .|:|:|||:.|||.||. ||.||
Zfish     4 VHYRFQSRLTYDSLQFEGLNISAGELKRQIMRSKRL-KFC--QLKISNAQTDEEYTDDA-LISKN 64

  Fly    68 TTLIISRIP-----------IAHPTKKGWEPPAAENAFSAAPAKQDNFNMDLSKMQGTEEDKIQA 121
            |::||.|||           :.|...: |..|:         .:.|...:.|.::          
Zfish    65 TSVIIRRIPAAGLKSSNRRFVGHQAGR-WREPS---------PRADPSLLSLEQL---------- 109

  Fly   122 MMMQSTVDYDPKTYHRIKGQSQVGEVPASYRCNKCKKSGHWIKNCPFVGGKDQQEVKRNTGIPRS 186
                            :||.                      ::.|      .:.::::||||||
Zfish   110 ----------------LKGS----------------------RSAP------HKRIRKSTGIPRS 130

  Fly   187 FR---DKPD---AAENESADFVLPAV 206
            |.   |.||   ...:.|..:|:|.:
Zfish   131 FLLEVDDPDRKGVMIDGSGRYVIPII 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snamaNP_611884.1 COG5222 3..315 CDD:227547 62/221 (28%)
DWNN 3..75 CDD:285936 38/71 (54%)
zf-CCHC_2 148..167 CDD:290419 0/18 (0%)
RING 217..260 CDD:238093
LOC100536005XP_009302385.1 COG5222 2..>168 CDD:227547 62/221 (28%)
DWNN 4..72 CDD:285936 38/71 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000125
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.