DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10339 and Aadacl3

DIOPT Version :10

Sequence 1:NP_611881.1 Gene:CG10339 / 37854 FlyBaseID:FBgn0034972 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_001078972.1 Gene:Aadacl3 / 230883 MGIID:2685281 Length:408 Species:Mus musculus


Alignment Length:248 Identity:40/248 - (16%)
Similarity:69/248 - (27%) Gaps:119/248 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DIELTPWKGIF-NATVFQPDCWQNAMPSVGKETEQILKIIQSDSSAQDAERKYEENCLYLNVFVP 136
            |:.:: ||.:. |.....||.|:.....:|.|.                              :|
Mouse   259 DVNIS-WKSVVKNGMHLPPDVWEKYRKWLGAEN------------------------------IP 292

  Fly   137 DGLPEINGYAVVVWIHSGDFSTGSPADVEPFQ------------LVFKQKVI-------VVTFSY 182
            :.... .||..:.|         .|.:.:.:|            |:.:..::       :|:..|
Mouse   293 ERFKN-RGYKSIPW---------GPVNNDAYQEIKRSLNYTCSPLISEDSIVSQLPETCIVSCEY 347

  Fly   183 RLNIFGFFTTDDGEAQGNYGLMDQSAALYWVKKNINFFGGDSNRITLMGHDAGAVSVALHMTSGE 247
            .|                  |.|.| .||  ||.:...|     :.:..|         ||    
Mouse   348 DL------------------LRDHS-LLY--KKRLEDLG-----VPVTWH---------HM---- 373

  Fly   248 WSKGGFHKAIIMSGNPLSTVKMPYEYEGSLDQVSSTFACPRRPTSMFIQCLKR 300
              :.|||..:                 .:||....:|.|..|...:.||.:::
Mouse   374 --EDGFHGVL-----------------SALDYGLLSFPCASRIMDLIIQFIRK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10339NP_611881.1 COesterase 30..560 CDD:395084 40/248 (16%)
Aadacl3NP_001078972.1 Abhydrolase_3 116..379 CDD:400284 32/201 (16%)
Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole. /evidence=ECO:0000250|UniProtKB:Q5NUF3 120..122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.