DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10339 and Nlgn2

DIOPT Version :10

Sequence 1:NP_611881.1 Gene:CG10339 / 37854 FlyBaseID:FBgn0034972 Length:603 Species:Drosophila melanogaster
Sequence 2:NP_942562.2 Gene:Nlgn2 / 216856 MGIID:2681835 Length:836 Species:Mus musculus


Alignment Length:56 Identity:14/56 - (25%)
Similarity:21/56 - (37%) Gaps:16/56 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GGGSNRAPIHDTPSSACSCRCGERNDASRIVGGQATGVNEFPWMARLSYFNRFYCG 109
            |.|..|..:.       :||.|         ...|.|....||:.||::|:.:..|
Mouse    83 GSGDGRIVLE-------ACRRG---------FSPAVGYELNPWLVRLAHFHAWRAG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10339NP_611881.1 COesterase 30..560 CDD:395084 14/56 (25%)
Nlgn2NP_942562.2 COesterase 42..601 CDD:395084 14/56 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..661
Required for interaction with LHFPL4. /evidence=ECO:0000269|PubMed:28279354 679..699
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 711..735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..836
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.