DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and WLIM1

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_172491.1 Gene:WLIM1 / 837558 AraportID:AT1G10200 Length:190 Species:Arabidopsis thaliana


Alignment Length:181 Identity:47/181 - (25%)
Similarity:70/181 - (38%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGY 72
            |.||.||.|:||..::..|....:||.||:|..|...|..:|....|..|:|:....:.:...| 
plant     7 TQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQNFKRTG- 70

  Fly    73 GFGGGAGCLSTDTGAHLNREFV-PPKI--PPKAPDG-----------LG-----CPRCGIYVYAA 118
                           .|.:.|. .|||  |.:..:|           .|     |..|...||..
plant    71 ---------------SLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPI 120

  Fly   119 EQMLARGKGYHRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARG 169
            |::...|..||:.||||.....|:..:.:.....| :||:..:.|....:|
plant   121 EKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGK-LYCKHHHIQLIKEKG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 19/52 (37%)
LIM_CRP_like 108..161 CDD:188712 16/52 (31%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
WLIM1NP_172491.1 LIM1_SF3 6..68 CDD:188824 20/60 (33%)
LIM2_SF3 110..170 CDD:188825 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm966
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.