DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and PLIM2c

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_191682.2 Gene:PLIM2c / 825295 AraportID:AT3G61230 Length:213 Species:Arabidopsis thaliana


Alignment Length:210 Identity:62/210 - (29%)
Similarity:86/210 - (40%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGY 72
            |.||.||.|:||..:.....|..:||:||:||.||..|...|.:..:..|:||. |..:...:..
plant     8 TDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKT-HFEQLFKESG 71

  Fly    73 GFGGG---AGCLSTDTGAHLNREFVPPKIPPKAPDGLG---------CPRCGIYVYAAEQMLARG 125
            .|...   ||.......|            .|||:.|.         |..|...||..|:|...|
plant    72 NFSKNFQTAGKTEKSNDA------------TKAPNRLSSFFSGTQDKCAACKKTVYPLEKMTMEG 124

  Fly   126 KGYHRRCFKCVQ--CNKTLDSTLHCDGPDKDIYCRGCYAQKFGARG-YGHIGISSLGLMSDIRDS 187
            :.||:.||:|..  |..|..|....||.   :||:..::|.|..:| |.|:    |...::.|.|
plant   125 ESYHKTCFRCAHSGCPLTHSSYAALDGV---LYCKVHFSQLFLEKGNYNHV----LQAAANHRRS 182

  Fly   188 EWQSDMA-PKASIIN 201
            ..:.|.. ||....|
plant   183 TAEEDKTEPKEDEAN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 21/52 (40%)
LIM_CRP_like 108..161 CDD:188712 19/54 (35%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
PLIM2cNP_191682.2 LIM1_SF3 7..69 CDD:188824 23/61 (38%)
LIM 107..167 CDD:413332 21/62 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm966
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.