DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and WLIM2b

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001190099.1 Gene:WLIM2b / 824743 AraportID:AT3G55770 Length:233 Species:Arabidopsis thaliana


Alignment Length:218 Identity:54/218 - (24%)
Similarity:79/218 - (36%) Gaps:73/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYGF 74
            ||.||.|:|||.|...|.|..:||:||||:.|...|..::.:..|..|:||....:.:...|   
plant     9 KCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHFEQLFKESG--- 70

  Fly    75 GGGAGCLSTDTGAHLNREFVPP-----KIPP---KAPDGLG---------CPRCGIYVYAAEQM- 121
                         ..|:.|..|     |..|   :.|..:.         |..|...||..|:: 
plant    71 -------------SFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATCSKTVYPIEKIH 122

  Fly   122 -------LAR--------------------------GKGYHRRCFKCVQ--CNKTLDSTLHCDGP 151
                   |||                          .:.||:.||||..  |..:..:....:| 
plant   123 NPLSYRELARKPNVLHRCIDPGDIGSCYFNLHVTVESQTYHKSCFKCSHGGCPISPSNYAALEG- 186

  Fly   152 DKDIYCRGCYAQKFGARG-YGHI 173
              .:||:..:||.|..:| |.|:
plant   187 --ILYCKHHFAQLFKEKGSYNHL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 23/52 (44%)
LIM_CRP_like 108..161 CDD:188712 18/88 (20%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
WLIM2bNP_001190099.1 LIM1_SF3 6..68 CDD:188824 23/58 (40%)
LIM 108..202 CDD:295319 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm966
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.