DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and CSRP3

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_003467.1 Gene:CSRP3 / 8048 HGNCID:2472 Length:194 Species:Homo sapiens


Alignment Length:180 Identity:89/180 - (49%)
Similarity:111/180 - (61%) Gaps:14/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYGF 74
            ||.||.|:||.|||....|..||||||.|..|.||||||....||.|::||.|:||:|||||.|:
Human     9 KCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGY 73

  Fly    75 GGGAGCLSTDTGAHLNREFV-------------PPKIPPKAPDGLGCPRCGIYVYAAEQMLARGK 126
            |.||||||||||.||..:|.             |.|...|..:...|||||..|||||:::..||
Human    74 GQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGK 138

  Fly   127 GYHRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYGHIGIS 176
            .:|:.||:|..|.|:|:||...| .|.::||:.|||:.||..|.|..|::
Human   139 PWHKTCFRCAICGKSLESTNVTD-KDGELYCKVCYAKNFGPTGIGFGGLT 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 30/52 (58%)
LIM_CRP_like 108..161 CDD:188712 25/52 (48%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
CSRP3NP_003467.1 Interaction with TCAP. /evidence=ECO:0000269|PubMed:12507422 1..5
LIM1_CRP3 9..62 CDD:188865 30/52 (58%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P50463, ECO:0000255 64..69 3/4 (75%)
Interaction with CLF2 and isoform 2. /evidence=ECO:0000269|PubMed:19752190, ECO:0000269|PubMed:24860983 94..105 0/10 (0%)
LIM2_CRP3 120..173 CDD:188866 26/53 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142494
Domainoid 1 1.000 86 1.000 Domainoid score I8089
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20742
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.