DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and crip2

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_012824147.1 Gene:crip2 / 780192 XenbaseID:XB-GENE-953187 Length:220 Species:Xenopus tropicalis


Alignment Length:294 Identity:82/294 - (27%)
Similarity:111/294 - (37%) Gaps:91/294 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFC-KNCHGRKYGPKGYG 73
            |||.|.|:||.||:..:.|..:||.|.||..|||.|:.....||:.:.:| |.|:...|||||..
 Frog     4 KCPKCDKTVYFAEKVTSLGKDWHKFCLKCERCNKTLNPGGHAEHDGKPYCHKPCYAALYGPKGVN 68

  Fly    74 FGGGAGCLSTDTGAHLNREFVPPKIPPKAPDGLGCPRCGIYVYAAEQMLARGKGYHRRCFKCVQC 138
            . ||||....|.....::...|.::.||                :::....|....|...|    
 Frog    69 I-GGAGSYIYDRKPSEDKPTSPTEVQPK----------------SDERKVSGPAPIRSLSK---- 112

  Fly   139 NKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYGHIGISSLGLMSDIRDSEWQSDMAPKASIINVE 203
                                       ||:|                        :|.|. |...
 Frog   113 ---------------------------GAQG------------------------SPPAD-ITAS 125

  Fly   204 QIQAPIGEG--CPRCGGVVFAAEQVLSKGRSWHRKCFKCRDCTKTLDSIIACDGP------DNEV 260
            .|....||.  ||||...|:.||:|.|.|:.|||.|.:|..|:|||.       |      |.:.
 Frog   126 SITTFTGEPNLCPRCAQKVYFAEKVTSLGKDWHRPCLRCERCSKTLT-------PGSHAEHDGQP 183

  Fly   261 YC-KTCYGKKWGPHGYGF-ACGSSFLQTDGITEE 292
            || |.|||..:||.|... ..||...:.:.:.:|
 Frog   184 YCHKPCYGILFGPKGVNTGGVGSYIYEKEPVNKE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 23/53 (43%)
LIM_CRP_like 108..161 CDD:188712 3/52 (6%)
LIM_CRP_like 213..266 CDD:188712 24/59 (41%)
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
crip2XP_012824147.1 LIM1_TLP 5..58 CDD:188860 22/52 (42%)
LIM1_TLP 137..190 CDD:188860 24/59 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.