DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and lima1

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001072345.1 Gene:lima1 / 779798 XenbaseID:XB-GENE-987339 Length:715 Species:Xenopus tropicalis


Alignment Length:220 Identity:54/220 - (24%)
Similarity:87/220 - (39%) Gaps:41/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DIRDSEWQSDMAPKASIIN---------VEQIQAPIGEGCPRCGGVVFAAEQVLSKGRSWHRKCF 238
            :|:.|....|.:|::.::|         |::.|.|..|.|..|...|:..|::.:..:.:|..||
 Frog   315 EIQRSSSSPDYSPQSRVLNTMEPSPPKSVKKFQLPAREVCFSCQKTVYPMERLFANNQVYHNGCF 379

  Fly   239 KCRDC-TK-TLDSIIACDGPDNEVYCKTCYG---KKWGPHGYGFA------CGSSFLQTDGITEE 292
            :|..| || :|.:..:..|   .||||..:.   |..|.:..||.      ...:..:|.. |||
 Frog   380 RCSHCSTKLSLGTFASLHG---TVYCKPHFNQLFKSKGNYDEGFGHKPHKELWVNKTETSE-TEE 440

  Fly   293 NLASERPFVAPDTTSIMAPDGEGCPRCGGAVFAAELQL------SKGKMYHRKCFNCARCTRPLD 351
            :.......::.|.:|   |..|..|.....|.||.::.      .|.|....|....| ...|.:
 Frog   441 SPEQTTAHISKDPSS---PVVEEAPIAKVGVLAASMEAKNSSAQDKEKQVETKRLKIA-WPPPAE 501

  Fly   352 SVLACDGPDDNIYCKLCYAKLFGPK 376
            |..|....::||       |:..||
 Frog   502 SSGAGGSGEENI-------KVLRPK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788
LIM_CRP_like 108..161 CDD:188712
LIM_CRP_like 213..266 CDD:188712 17/54 (31%)
LIM 316..369 CDD:413332 13/58 (22%)
LIM_CRP_like 412..465 CDD:188712
lima1NP_001072345.1 LIM_Eplin_alpha_beta 354..406 CDD:188869 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.