powered by:
Protein Alignment Mlp60A and Crip1
DIOPT Version :9
Sequence 1: | NP_001137750.1 |
Gene: | Mlp60A / 37853 |
FlyBaseID: | FBgn0259209 |
Length: | 486 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001128405.1 |
Gene: | Crip1 / 691657 |
RGDID: | 1597237 |
Length: | 77 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 31/69 - (44%) |
Similarity: | 40/69 - (57%) |
Gaps: | 1/69 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 PKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKN-CHGRKYGPKGY 72
||||.|.|.||.||...:.|..:|:.|.||..|.|.|.|....|||.:.:|.: |:...:||||:
Rat 2 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGF 66
Fly 73 GFGG 76
|.||
Rat 67 GRGG 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1700 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
71 |
1.000 |
Inparanoid score |
I5215 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1214165at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000284 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.870 |
|
Return to query results.
Submit another query.