DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and mical2b

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_005174396.1 Gene:mical2b / 569564 ZFINID:ZDB-GENE-061207-15 Length:1679 Species:Danio rerio


Alignment Length:259 Identity:57/259 - (22%)
Similarity:89/259 - (34%) Gaps:78/259 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 CPRCGIYVYAAEQMLARGKGYHRRCFKCVQCNKTLDSTLHC-DGPDKDIYCRGCYAQKFGA---- 167
            |..|...||..|::.|.|..:||.||:|..|..:|....|. |......||:..::|:..:    
Zfish  1013 CVFCQKRVYIMERLSAEGFFFHRECFRCHICGCSLRLGAHTFDSQQGTFYCKMHFSQRKTSTRHR 1077

  Fly   168 RGY---GHIGISSLGLMSDIR-------------DSEWQSD---MAPKASIINVEQI-----QAP 208
            ||.   |.|..||:.:.:...             ||..|.|   :.....||:|.::     :|.
Zfish  1078 RGEIQDGGIRSSSITISNHTSTDGTRGQPSGGEFDSSTQQDLQTLPDSKEIISVSEVKDSSKKAD 1142

  Fly   209 IGEGCPRCGGVVF-------AAEQVLSKGRSWHRKCFKCRDCTKTLDSIIACDGPDNEVYCKTCY 266
            ..:..|.|.....       |..::.:|...|.:|      ...||..::.              
Zfish  1143 PADSAPACPDSPLQKVKRSTAKGEITNKNILWKKK------IRSTLPLVLM-------------- 1187

  Fly   267 GKKWGPHGYGFACGSSFLQTDGITE-----------ENLASERPFVAPDTTSIMAP--DGEGCP 317
             ||       |..|....:|:.:.|           |:|:|::| ..|.|.|...|  |....|
Zfish  1188 -KK-------FHRGKPEDKTEVLAEEDGNSDFEEIHESLSSKKP-SNPSTDSNCLPTKDNSSTP 1242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788
LIM_CRP_like 108..161 CDD:188712 18/53 (34%)
LIM_CRP_like 213..266 CDD:188712 8/59 (14%)
LIM 316..369 CDD:413332 1/2 (50%)
LIM_CRP_like 412..465 CDD:188712
mical2bXP_005174396.1 FAD_binding_3 86..>274 CDD:332373
CH 522..623 CDD:306753
LIM_Mical 1013..1067 CDD:188823 18/53 (34%)
Atrophin-1 1080..>1344 CDD:331285 36/192 (19%)
YesN <1308..1371 CDD:330857
DUF3585 1530..1665 CDD:314926
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.