DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and crip3

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_021323078.1 Gene:crip3 / 556515 ZFINID:ZDB-GENE-130530-620 Length:213 Species:Danio rerio


Alignment Length:209 Identity:73/209 - (34%)
Similarity:93/209 - (44%) Gaps:42/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 CPRCGGVVFAAEQVLSKGRSWHRKCFKCRDCTKTLDSIIACDG---PDNEVYC-KTCYGKKWGPH 273
            ||||...||.||:|.|.|::|||.|.||..|:|    |::..|   .|...|| |.|||..:||.
Zfish     5 CPRCDKTVFFAEKVSSLGKNWHRFCLKCERCSK----ILSPGGHAEHDGLPYCHKPCYGTLFGPK 65

  Fly   274 GYGFACGSSFL-----QTDGITEENLASERPFVAPDTTS---------------IMAPDGEGCPR 318
            |.......|::     ||......|..||.....|.|||               :.|.:...||.
Zfish    66 GVNIGGAGSYIYDTPPQTPVNKTCNSPSEGSPTTPWTTSQINFNQPKAATAPARMFAGETYLCPG 130

  Fly   319 CGGAVFAAELQLSKGKMYHRKCFNCARCTRPLDSVLACDGP------DDNIYCKL-CYAKLFGPK 376
            ||.||:.||..:|.|:.:||.|..|.||.:.|.       |      :.:.||.: ||..|||||
Zfish   131 CGKAVYFAEKVMSLGRNWHRPCLRCVRCKKTLT-------PGGHAEHEGSPYCHVPCYGYLFGPK 188

  Fly   377 GVGYGHTPTLVSTN 390
            ||..|.....:..|
Zfish   189 GVNIGRVGCYIYEN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788
LIM_CRP_like 108..161 CDD:188712
LIM_CRP_like 213..266 CDD:188712 25/56 (45%)
LIM 316..369 CDD:413332 20/59 (34%)
LIM_CRP_like 412..465 CDD:188712
crip3XP_021323078.1 LIM1_TLP 5..58 CDD:188860 25/56 (45%)
LIM2_TLP 128..181 CDD:188861 20/59 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.