DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and csrp2

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_012814488.1 Gene:csrp2 / 549369 XenbaseID:XB-GENE-943913 Length:196 Species:Xenopus tropicalis


Alignment Length:174 Identity:77/174 - (44%)
Similarity:106/174 - (60%) Gaps:12/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYGF 74
            ||.|||.:||.|||....|..:||.||.|.:|.|.||||....|:.|::|::|:|:||||||||:
 Frog    13 KCGACGSNVYHAEEVQCDGKSYHKCCFLCMVCRKNLDSTTVAIHDNEIYCRSCYGKKYGPKGYGY 77

  Fly    75 GGGAGCLSTDTGAHL-----------NREFVPPKIPPKAPDGLGCPRCGIYVYAAEQMLARGKGY 128
            |.|||.|:.|.|..|           |....|.|...|......||||...|||||:::..||.:
 Frog    78 GQGAGTLNMDRGERLGIKPEENLARQNTSSNPSKFAQKFGGAEKCPRCNESVYAAEKIMGAGKPW 142

  Fly   129 HRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYGH 172
            |:.||:|.:|.|:|:||...: .:.:|||:.|||:.||.:|:|:
 Frog   143 HKNCFRCAKCGKSLESTTLTE-KEGEIYCKACYAKNFGPKGFGY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 25/52 (48%)
LIM_CRP_like 108..161 CDD:188712 23/52 (44%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
csrp2XP_012814488.1 LIM1_CRP2 13..67 CDD:188864 26/53 (49%)
LIM2_CRP2 122..175 CDD:188871 24/53 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8277
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.