DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and crip3

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001015811.1 Gene:crip3 / 548528 XenbaseID:XB-GENE-5943480 Length:203 Species:Xenopus tropicalis


Alignment Length:195 Identity:66/195 - (33%)
Similarity:96/195 - (49%) Gaps:28/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFC-KNCHGRKYGPKG 71
            |.:||.|...||.||:..:.|..:|:.|.||.:|||.|.:....||:.:.:| |.|:|..:||||
 Frog     2 TSQCPRCRAPVYFAEKVSSLGKNWHRFCLKCELCNKILSAGGHAEHDGQPYCHKPCYGALFGPKG 66

  Fly    72 YGFGGGAGCLSTDTGAHLNREFVPP-------------KIPPKAPDGLG--------CPRCGIYV 115
            ... ||.|....||...:::..|.|             |...|||..:.        ||.||..|
 Frog    67 VNI-GGVGSYIYDTTPQISQNPVSPTLCVPNHSSSTNTKPATKAPAPMRTFAGETALCPGCGKPV 130

  Fly   116 YAAEQMLARGKGYHRRCFKCVQCNKTLDSTLHCDGPDKDIYCR-GCYAQKFGARGYGHIGISSLG 179
            :.||::::.|:.:||.|.:|.:|||||.:..|.: .|...||. .||...||.:|   :.|..:|
 Frog   131 FFAEKVMSLGRNWHRPCLRCQRCNKTLTAGGHAE-HDGLPYCHVPCYGYLFGPKG---VNIGDVG 191

  Fly   180  179
             Frog   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 20/53 (38%)
LIM_CRP_like 108..161 CDD:188712 21/53 (40%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
crip3NP_001015811.1 LIM1_TLP 5..58 CDD:188860 20/52 (38%)
LIM2_TLP 123..176 CDD:188861 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.