DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mlp60A and LIMA1

DIOPT Version :9

Sequence 1:	NP_001137750.1	Gene:	Mlp60A / 37853	FlyBaseID:	FBgn0259209	Length:	486	Species:	Drosophila melanogaster
Sequence 2:	NP_001107018.1	Gene:	LIMA1 / 51474	HGNCID:	24636	Length:	760	Species:	Homo sapiens

Alignment Length:	103	Identity:	35/103 - (33%)
Similarity:	48/103 - (46%)	Gaps:	16/103 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    81 LSTDTGAHLNREFVPPKIPPK--APDGLGCPRCGIYVYAAEQMLARGKGYHRRCFKCVQCNKTLD 143
            ||.|:.|....|..|||...|  ||....|..|...||..|::||..:.:|..||:|..||..|.
Human   362 LSPDSRASSLSESSPPKAMKKFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLS 426

  Fly   144 ----STLHCDGPDKDIYCRGCYAQKFGAR-----GYGH 172
                ::||     ..|||:..:.|.|.::     |:||
Human   427 LGTYASLH-----GRIYCKPHFNQLFKSKGNYDEGFGH 459

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mlp60A	NP_001137750.1	LIM1_MLP84B_like	10..63	CDD:188788
		LIM_CRP_like	108..161	CDD:188712	19/56 (34%)
		LIM_CRP_like	213..266	CDD:188712
		LIM	316..369	CDD:413332
		LIM_CRP_like	412..465	CDD:188712
LIMA1	NP_001107018.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	78..131
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	146..182
		Required for interaction with NPC1L1. /evidence=ECO:0000250\|UniProtKB:Q9ERG0	164..166
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	211..264
		LIM_Eplin_alpha_beta	391..443	CDD:188869	19/56 (34%)
		Required for interaction with MYO5B. /evidence=ECO:0000250\|UniProtKB:Q9ERG0	494..514
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	510..710
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1700
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810