DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and csrp3

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001307020.1 Gene:csrp3 / 450005 ZFINID:ZDB-GENE-041010-119 Length:222 Species:Danio rerio


Alignment Length:177 Identity:84/177 - (47%)
Similarity:106/177 - (59%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYGF 74
            ||.||.|:||.|||.......||||||.|.:|.|.||||....||.|::||.|:|:||||||||:
Zfish    38 KCAACEKTVYHAEEIQCNSRSFHKTCFICMVCRKGLDSTTVAAHESEIYCKTCYGKKYGPKGYGY 102

  Fly    75 GGGAGCLSTDTGAHLNREFVP--PKIPPKAPDGLG-------------CPRCGIYVYAAEQMLAR 124
            |.|||.||:|...  |.|..|  ||.|..||....             ||||...|||||:::..
Zfish   103 GQGAGALSSDPVN--NEELQPQEPKAPRPAPANSNSSKFAQKFGSTDRCPRCSKAVYAAEKIMGA 165

  Fly   125 GKGYHRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYG 171
            ||.:|:.||:|:.|.|:|:||...| .|.::||:.|||:.||.:|.|
Zfish   166 GKPWHKTCFRCLLCGKSLESTTVTD-KDGELYCKVCYAKNFGPKGRG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 28/52 (54%)
LIM_CRP_like 108..161 CDD:188712 24/52 (46%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
csrp3NP_001307020.1 LIM1_CRP3 38..91 CDD:188865 28/52 (54%)
LIM2_CRP3 149..202 CDD:188866 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575194
Domainoid 1 1.000 79 1.000 Domainoid score I8580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20742
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.