DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and csrp1

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001006881.1 Gene:csrp1 / 448688 XenbaseID:XB-GENE-941448 Length:193 Species:Xenopus tropicalis


Alignment Length:174 Identity:84/174 - (48%)
Similarity:107/174 - (61%) Gaps:13/174 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYGF 74
            ||..|.||||.|||....|..|||:||.|.:|.|.||||....|.:|::||:|:|:|||||||||
 Frog     9 KCTVCQKSVYFAEEVQCEGGSFHKSCFLCMVCKKNLDSTTVAIHGEEIYCKSCYGKKYGPKGYGF 73

  Fly    75 GGGAGCLSTDTGAHLNREFVPP--KIPPKAPDG------LG----CPRCGIYVYAAEQMLARGKG 127
            |.|||.||.|.|.||..:...|  ..|...|:.      :|    ||||...|||||:::..|..
 Frog    74 GQGAGTLSMDRGEHLGIQTDDPSRSQPTNNPNASKFAQKVGGTDICPRCSKSVYAAEKVIGAGNS 138

  Fly   128 YHRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYG 171
            :||.||:|.:|.|.|:||...| .|.||:|:.|||:.||.:|:|
 Frog   139 WHRTCFRCSKCGKGLESTTVAD-RDGDIFCKACYAKNFGPKGFG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 27/52 (52%)
LIM_CRP_like 108..161 CDD:188712 25/52 (48%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
csrp1NP_001006881.1 LIM1_CRP1 8..63 CDD:188863 28/53 (53%)
LIM2_CRP 119..172 CDD:188787 26/53 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8277
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.