DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and csrp3

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001006836.1 Gene:csrp3 / 448578 XenbaseID:XB-GENE-1010170 Length:194 Species:Xenopus tropicalis


Alignment Length:282 Identity:103/282 - (36%)
Similarity:124/282 - (43%) Gaps:102/282 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYGF 74
            ||.||.|:||.|||....|..|||.||.|.:|.||||||....||.|::||:|:||||||||||:
 Frog     9 KCGACDKTVYHAEEIQCNGRSFHKPCFICMVCRKALDSTTVAAHESEIYCKSCYGRKYGPKGYGY 73

  Fly    75 GGGAGCLSTDTGAHLNREFVPPKIPPKAPDGLGCPRCGIYVYAAEQMLARGKGYHRRCFKCVQCN 139
            |.||||||||||                      .|.||.|  ||...|||.             
 Frog    74 GQGAGCLSTDTG----------------------ERFGIEV--AESHPARGS------------- 101

  Fly   140 KTLDSTLHCDGPDKDIYCRGCYAQKFGARGYGHIGISSLGLMSDIRDSEWQSDMAPKASIINVEQ 204
               .:|.|...          :.|||||.                                    
 Frog   102 ---PTTTHTSK----------FTQKFGAT------------------------------------ 117

  Fly   205 IQAPIGEGCPRCGGVVFAAEQVLSKGRSWHRKCFKCRDCTKTLDSIIACDGPDNEVYCKTCYGKK 269
                  |.||||...|:|||:|:..|:.||:.||:|..|.|:|||....: .|.|:|||.||.|.
 Frog   118 ------EKCPRCQKSVYAAERVMGGGQPWHKTCFRCAFCGKSLDSTTVTE-KDGEIYCKVCYAKS 175

  Fly   270 WGPHGYGFACGSSFLQTDGITE 291
            :||.|.||.         |:|:
 Frog   176 FGPKGIGFG---------GLTQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 29/52 (56%)
LIM_CRP_like 108..161 CDD:188712 11/52 (21%)
LIM_CRP_like 213..266 CDD:188712 25/52 (48%)
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
csrp3NP_001006836.1 LIM1_CRP3 9..62 CDD:188865 29/52 (56%)
LIM2_CRP3 120..173 CDD:188866 26/53 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8277
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20742
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.