DRSC - DRSC Integrative Ortholog Prediction Tool

Protein Alignment Mlp60A and ZK622.5

Sequence 1:	NP_001137750.1	Gene:	Mlp60A / 37853	FlyBaseID:	FBgn0259209	Length:	486	Species:	Drosophila melanogaster
Sequence 2:	NP_001040831.1	Gene:	ZK622.5 / 4363029	WormBaseID:	WBGene00044667	Length:	182	Species:	Caenorhabditis elegans

Alignment Length:	31	Identity:	10/31 - (32%)
Similarity:	12/31 - (38%)	Gaps:	14/31 - (45%)

- Green bases have known domain annotations that are detailed below.

  Fly   153 KDIYC-------RGC-------YAQKFGARG 169
            ||:||       .||       .:.|.||.|
Worm   150 KDVYCDDRHDEFMGCESVFVYHLSWKRGATG 180

Gene	Sequence	Domain	Region	External ID	Identity
Mlp60A	NP_001137750.1	LIM1_MLP84B_like	10..63	CDD:188788
		LIM_CRP_like	108..161	CDD:188712	6/21 (29%)
		LIM_CRP_like	213..266	CDD:188712
		LIM	316..369	CDD:413332
		LIM_CRP_like	412..465	CDD:188712
ZK622.5	NP_001040831.1	None
Blue background indicates that the domain is not in the aligned region.