DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and Mical

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001247015.1 Gene:Mical / 41225 FlyBaseID:FBgn0053208 Length:4743 Species:Drosophila melanogaster


Alignment Length:249 Identity:60/249 - (24%)
Similarity:83/249 - (33%) Gaps:83/249 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LDST--NCTEHEK--ELFCKNCHGRKYGPKGYGFGGGAGCLSTDTGAHLNREFVPPKIPPKAPDG 105
            :||.  |..|.||  ||..|.   ..:||||                   ||.||.         
  Fly   953 IDSNDWNVREIEKKIELSKKT---EIHGPKG-------------------REKVPK--------- 986

  Fly   106 LGCPRCGIYVYAAEQMLARGKGYHRRC------------FKCV-QCNKTLDSTLHCDGPDKDIYC 157
                      ::.||..||   .|:..            ||.: |..:.||..|. :|.:.|:..
  Fly   987 ----------WSKEQFQAR---QHKMSKPQRQDSREAEKFKDIDQTIRNLDKQLK-EGHNLDVGE 1037

  Fly   158 RG-----CYAQKFGARGYGHIGISSLGLMSDIRDSEWQSDMAPKAS--IINVEQIQAPIGEGCPR 215
            ||     ..|.:||.:...:....:.|  |....:...:.:.||:|  :....:.|| ..|.|..
  Fly  1038 RGRNKVASIAGQFGKKDEANSDEKNAG--SSNATTNTNNTVIPKSSSKVALAFKKQA-ASEKCRF 1099

  Fly   216 CGGVVFAAEQVLSKGRSWHRKCFKCRDCTKTL-------DSIIACDGPDNEVYC 262
            |...|:..|:...:|...||.|.||..|...|       |.    |.|....||
  Fly  1100 CKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDR----DDPQGRFYC 1149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 9/21 (43%)
LIM_CRP_like 108..161 CDD:188712 15/70 (21%)
LIM_CRP_like 213..266 CDD:188712 17/57 (30%)
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
MicalNP_001247015.1 MDR <114..>160 CDD:302572
CH 563..>629 CDD:294029
LIM_Mical 1097..1153 CDD:188823 17/57 (30%)
Ehrlichia_rpt <2081..2479 CDD:118064
DUF3585 4592..4705 CDD:288945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2983
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.