Sequence 1: | NP_001137750.1 | Gene: | Mlp60A / 37853 | FlyBaseID: | FBgn0259209 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_996805.2 | Gene: | CRIP3 / 401262 | HGNCID: | 17751 | Length: | 204 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 68/205 - (33%) |
---|---|---|---|
Similarity: | 90/205 - (43%) | Gaps: | 33/205 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 CPRCGGVVFAAEQVLSKGRSWHRKCFKCRDCTKTLDSIIACDG---PDNEVYC-KTCYGKKWGPH 273
Fly 274 GYGFACGSSFLQ---------TDGITEENLASERPFV-------APDTTSIMAPDGEGCPRCGGA 322
Fly 323 VFAAELQLSKGKMYHRKCFNCARCTRPLDSVLACDGPDDNI-YCKL-CYAKLFGPKGVGYGHTPT 385
Fly 386 LVSTNYEYTP 395 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mlp60A | NP_001137750.1 | LIM1_MLP84B_like | 10..63 | CDD:188788 | |
LIM_CRP_like | 108..161 | CDD:188712 | |||
LIM_CRP_like | 213..266 | CDD:188712 | 24/56 (43%) | ||
LIM | 316..369 | CDD:413332 | 19/54 (35%) | ||
LIM_CRP_like | 412..465 | CDD:188712 | |||
CRIP3 | NP_996805.2 | LIM1_TLP | 5..58 | CDD:188860 | 24/56 (43%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 84..112 | 3/27 (11%) | |||
LIM2_TLP | 124..177 | CDD:188861 | 19/54 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1700 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1214165at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000284 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |