DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and csrp1a

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_991130.1 Gene:csrp1a / 378726 ZFINID:ZDB-GENE-030909-4 Length:192 Species:Danio rerio


Alignment Length:175 Identity:82/175 - (46%)
Similarity:104/175 - (59%) Gaps:13/175 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYGF 74
            ||..|.|:||.|||....|..||::||.|.:|.|.||||....||.|::||.|:|:||||||||:
Zfish     8 KCGCCQKTVYFAEEVQCEGRSFHRSCFLCMVCRKNLDSTTVAVHENEIYCKACYGKKYGPKGYGY 72

  Fly    75 GGGAGCLSTDTGAHLNREFVPP------------KIPPKAPDGLGCPRCGIYVYAAEQMLARGKG 127
            |.|||.||.|.|..|..:.|.|            |...|......||||...|||||:::..|..
Zfish    73 GAGAGTLSMDKGESLGIKVVEPQNHQPTNNPNTSKFAQKFGGSDVCPRCSKAVYAAEKVIGAGNA 137

  Fly   128 YHRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYGH 172
            :||.||:|..|.|.|:||...| .|.:|||:||||:.||.:|:|:
Zfish   138 WHRGCFRCAMCGKGLESTTLAD-KDGEIYCKGCYAKNFGPKGFGY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 26/52 (50%)
LIM_CRP_like 108..161 CDD:188712 26/52 (50%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
csrp1aNP_991130.1 LIM1_CRP1 7..62 CDD:188863 27/53 (51%)
LIM2_CRP 118..171 CDD:188787 27/53 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575191
Domainoid 1 1.000 79 1.000 Domainoid score I8580
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.