DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and Hil

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster


Alignment Length:278 Identity:62/278 - (22%)
Similarity:93/278 - (33%) Gaps:108/278 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 CPRCGIYVYAAEQM--LARGKGYHRRCFKCVQCN-----KTLDSTLHCDGPDKDIYCRGCYAQKF 165
            |.||...||..:::  |.....:|..|||||.|.     ||..:..| ...||::|| ..:..|.
  Fly    11 CLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQH-KQDDKEVYC-SSHVPKS 73

  Fly   166 GARGYGHIGISSLGLMSDIRDSEWQSDMAPKASIINVEQIQAPIGE--GCPRCGGVVFAAEQVLS 228
            |.   ||:..:|:|:.        |:..||:.:....|||:....|  |.|..|.          
  Fly    74 GP---GHLDQTSVGIR--------QALNAPRTNKFVNEQIRGTRSEVDGGPLGGS---------- 117

  Fly   229 KGRSWHRKCFKCRDCTKTLDSIIACDGPDNEVYCKTCYGKKWGPHGYGFACGSSFLQTDGITEEN 293
                        |..|                           |:|||....||..|.|      
  Fly   118 ------------RQST---------------------------PNGYGSREISSPSQND------ 137

  Fly   294 LASERPFVAPDTTSIMAPDGEGCPRCGGAVFAAELQLSKGKMYHRKCFNCARCTRPLDSVLACD- 357
              |:..:...|.:::         ....|:...|:|         |.:|.|| .:|:|..||.: 
  Fly   138 --SDYKYGRFDASAL---------HIAHALKQTEIQ---------KAYNKAR-EKPIDFYLAREE 181

  Fly   358 ---------GPDDNIYCK 366
                     ..:|::|.|
  Fly   182 QAHLEMKHRKEEDDLYRK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788
LIM_CRP_like 108..161 CDD:188712 20/59 (34%)
LIM_CRP_like 213..266 CDD:188712 4/52 (8%)
LIM 316..369 CDD:413332 14/61 (23%)
LIM_CRP_like 412..465 CDD:188712
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 20/60 (33%)
BAR <147..>265 CDD:299863 14/72 (19%)
TGc 418..486 CDD:214673
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.