DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and Crip2

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_071946.1 Gene:Crip2 / 338401 RGDID:1302959 Length:208 Species:Rattus norvegicus


Alignment Length:211 Identity:68/211 - (32%)
Similarity:96/211 - (45%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFC-KNCHGRKYGPKGYG 73
            |||.|.|:||.||:..:.|..:||.|.||..|||.|......||:.:.|| |.|:...:||||..
  Rat     4 KCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCNKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVN 68

  Fly    74 FGGGAGCLSTDTGAHLNREFVPPKI------------PPKAPDGLG-----------CPRCGIYV 115
            .||....:.........:...|.::            |||.|....           ||||...|
  Rat    69 IGGAGSYIYEKPPTEAPQVTGPIEVPVVRTEERKTSGPPKGPSKASSVTTFTGEPNMCPRCNKRV 133

  Fly   116 YAAEQMLARGKGYHRRCFKCVQCNKTLDSTLHCDGPDKDIYC-RGCYAQKFGARGYGHIGISSLG 179
            |.||::.:.||.:||.|.:|.:|:|||....|.: .|...|| :.||...||.:|   :...::|
  Rat   134 YFAEKVTSLGKDWHRPCLRCERCSKTLTPGGHAE-HDGQPYCHKPCYGILFGPKG---VNTGAVG 194

  Fly   180 LMSDIRDSEWQSDMAP 195
              |.|.|.:.:..:.|
  Rat   195 --SYIYDKDPEGTVQP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 24/53 (45%)
LIM_CRP_like 108..161 CDD:188712 22/53 (42%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
Crip2NP_071946.1 LIM1_TLP 5..58 CDD:188860 23/52 (44%)
LIM1_TLP 126..179 CDD:188860 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.