DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and Csrp1

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_058844.1 Gene:Csrp1 / 29276 RGDID:62053 Length:193 Species:Rattus norvegicus


Alignment Length:174 Identity:83/174 - (47%)
Similarity:108/174 - (62%) Gaps:13/174 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPKGYGF 74
            ||..|.|:||.|||....|..|||:||.|.:|.|.||||....|.:|::||:|:|:||||||||:
  Rat     9 KCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGY 73

  Fly    75 GGGAGCLSTDTGAHL--NREFVPPKIPPKAPDG------LG----CPRCGIYVYAAEQMLARGKG 127
            |.|||.||.|.|..|  ..|..|...|...|:.      :|    ||||...|||||:::..||.
  Rat    74 GQGAGTLSMDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKS 138

  Fly   128 YHRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYG 171
            :|:.||:|.:|.|.|:||...| .|.:|||:||||:.||.:|:|
  Rat   139 WHKSCFRCAKCGKGLESTTLAD-KDGEIYCKGCYAKNFGPKGFG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 26/52 (50%)
LIM_CRP_like 108..161 CDD:188712 26/52 (50%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
Csrp1NP_058844.1 LIM1_CRP1 8..63 CDD:188863 27/53 (51%)
Nuclear localization signal. /evidence=ECO:0000255 64..69 3/4 (75%)
LIM2_CRP 119..172 CDD:188787 27/53 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.