DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and Mical3

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_036021853.1 Gene:Mical3 / 194401 MGIID:2442733 Length:2252 Species:Mus musculus


Alignment Length:111 Identity:34/111 - (30%)
Similarity:45/111 - (40%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FGGGAGCLSTDTGAHLNREFVPP---------KIPPKAPDGLG----CPRCGIYVYAAEQMLARG 125
            :.||...|:......|.|:..|.         .|..:.|..||    |..|...||..|::.|.|
Mouse   869 YTGGVSSLAEQIANQLQRKEQPKTLLDKKELGSIKKEFPQNLGGSDTCYFCQKRVYVMERLSAEG 933

  Fly   126 KGYHRRCFKCVQCNKTLDSTLHC-DGPDKDIYCRGCYAQKFGARGY 170
            |.:||.||||..|..||..:.:. |..|...||:..|..:..  ||
Mouse   934 KFFHRSCFKCEYCATTLRLSAYAYDIEDGKFYCKPHYCYRLS--GY 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788
LIM_CRP_like 108..161 CDD:188712 21/53 (40%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
Mical3XP_036021853.1 FAD_binding_3 87..>274 CDD:396193
CH_MICAL3 515..625 CDD:409100
LIM_Mical 916..970 CDD:188823 21/53 (40%)
PHA03307 1280..>1709 CDD:223039
DUF3585 2065..2233 CDD:403377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.