DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and exc-9

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_501326.2 Gene:exc-9 / 177586 WormBaseID:WBGene00017644 Length:85 Species:Caenorhabditis elegans


Alignment Length:70 Identity:28/70 - (40%)
Similarity:42/70 - (60%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKCPACGKSVYAAEERVAGGYKFHKTCFKC--SMCNKALDSTNCTEHEKELFCKNCHGRKYGPKG 71
            |.||.|.|:||.||...:.|:.:|:.|.:|  ..|.|.|.:.:.:|.|.:.:|..|:|..:||:|
 Worm     2 PNCPRCQKAVYFAERVTSIGFDWHRPCLRCENEACKKTLAAGSHSEREGKPYCNRCYGALFGPRG 66

  Fly    72 YGFGG 76
            ||.||
 Worm    67 YGHGG 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 18/54 (33%)
LIM_CRP_like 108..161 CDD:188712
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
exc-9NP_501326.2 LIM_TLP_like 4..58 CDD:188785 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.