DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and mlp-1

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001367782.1 Gene:mlp-1 / 175847 WormBaseID:WBGene00003375 Length:115 Species:Caenorhabditis elegans


Alignment Length:109 Identity:67/109 - (61%)
Similarity:74/109 - (67%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFVPVETPKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGR 65
            |||.|||.||||.||||||||||..|||||:||.|||||||||.|||.:|.||:.:||||.||.|
 Worm     1 MPFKPVEHPKCPKCGKSVYAAEEMSAGGYKWHKFCFKCSMCNKLLDSMSCCEHQAQLFCKQCHCR 65

  Fly    66 KYGPKGYGFGGGAGCLSTDTGAHLNREFVPPKIPPKAPDGLGCP 109
            :|||||.|||.|||.|:.|||.......|.....|...:....|
 Worm    66 RYGPKGIGFGIGAGSLTMDTGEQFGNTEVDMTNRPMTAEAFTAP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 39/52 (75%)
LIM_CRP_like 108..161 CDD:188712 1/2 (50%)
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
mlp-1NP_001367782.1 LIM1_MLP84B_like 10..63 CDD:188788 39/52 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158561
Domainoid 1 1.000 99 1.000 Domainoid score I4453
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I3022
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49444
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.940

Return to query results.
Submit another query.