powered by:
Protein Alignment Mlp60A and ltd-1
DIOPT Version :9
Sequence 1: | NP_001137750.1 |
Gene: | Mlp60A / 37853 |
FlyBaseID: | FBgn0259209 |
Length: | 486 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495697.2 |
Gene: | ltd-1 / 174301 |
WormBaseID: | WBGene00003089 |
Length: | 723 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 25/68 - (36%) |
Similarity: | 33/68 - (48%) |
Gaps: | 12/68 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 CPACGKSVYAAEERVAGGYK----FHKTCFKCSMCNKALD-STNCTE----HEKELFCKNCHGRK 66
|..|||.||..:: .|..| ||:.||||.:|...|. .|.|.. ::||::|.| |...
Worm 7 CNRCGKQVYPTDK--VGPLKDSTFFHQGCFKCYICGTRLALKTYCNNRNDINDKEVYCSN-HVPI 68
Fly 67 YGP 69
.||
Worm 69 AGP 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1700 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.