DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp60A and ltd-1

DIOPT Version :9

Sequence 1:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_495697.2 Gene:ltd-1 / 174301 WormBaseID:WBGene00003089 Length:723 Species:Caenorhabditis elegans


Alignment Length:68 Identity:25/68 - (36%)
Similarity:33/68 - (48%) Gaps:12/68 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CPACGKSVYAAEERVAGGYK----FHKTCFKCSMCNKALD-STNCTE----HEKELFCKNCHGRK 66
            |..|||.||..::  .|..|    ||:.||||.:|...|. .|.|..    ::||::|.| |...
 Worm     7 CNRCGKQVYPTDK--VGPLKDSTFFHQGCFKCYICGTRLALKTYCNNRNDINDKEVYCSN-HVPI 68

  Fly    67 YGP 69
            .||
 Worm    69 AGP 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 22/60 (37%)
LIM_CRP_like 108..161 CDD:188712
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
ltd-1NP_495697.2 LIM_Ltd-1 7..66 CDD:188827 22/61 (36%)
CYK3 <295..>484 CDD:227604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.