powered by:
Protein Alignment Mlp60A and zgc:195282
DIOPT Version :9
Sequence 1: | NP_001137750.1 |
Gene: | Mlp60A / 37853 |
FlyBaseID: | FBgn0259209 |
Length: | 486 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005168380.1 |
Gene: | zgc:195282 / 100192223 |
ZFINID: | ZDB-GENE-081022-208 |
Length: | 107 |
Species: | Danio rerio |
Alignment Length: | 49 |
Identity: | 17/49 - (34%) |
Similarity: | 27/49 - (55%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 EERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCKNCHGRKYGPK 70
|::.:.|..:|..|.||..|.:.|......||:::.||.||..|.:||:
Zfish 43 EKKRSLGRDYHPLCLKCHKCKRQLTPGQHAEHDEKPFCTNCFMRDFGPR 91
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1700 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
74 |
1.000 |
Inparanoid score |
I5271 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1214165at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000284 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.870 |
|
Return to query results.
Submit another query.