DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpat4 and CG34348

DIOPT Version :10

Sequence 1:NP_001286818.1 Gene:Gpat4 / 37852 FlyBaseID:FBgn0034971 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster


Alignment Length:33 Identity:11/33 - (33%)
Similarity:19/33 - (57%) Gaps:3/33 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SIWVFGFFIRYVI--LMPLRVLVCFVGVLFAVL 200
            |:|::.|....::  |:|| |.|..:.:.|.||
  Fly    24 SLWLYRFLTPLIVTFLLPL-VFVALIYISFLVL 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpat4NP_001286818.1 LPLAT_LPCAT1-like 307..513 CDD:153253
CG34348NP_001096954.1 LPLAT_MGAT-like 90..298 CDD:153249
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.