DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Magi3

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001152826.1 Gene:Magi3 / 99470 MGIID:1923484 Length:1476 Species:Mus musculus


Alignment Length:360 Identity:75/360 - (20%)
Similarity:130/360 - (36%) Gaps:86/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TTMSASSNTNSL-IEKEIDDEDMLSPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPL 89
            |.:|..:|.::| :.:...:...|..:|...:   :|:|....|...|..    |.....||..:
Mouse    79 TPVSGLTNRDTLAVIRHFREPIRLKTVKPGKV---INKDLRHYLSLQFQK----GSIDHKLQQVI 136

  Fly    90 R----MRKLPNSFFTPPAPSHSRANSADSTY----------DAGS--QSSINIGNKASIVQQPDG 138
            |    :|.:|   .|..||........|..:          ::|:  :|....||.....:.|..
Mouse   137 RDNLYLRTIP---CTTRAPRDGEVPGVDYNFISVEQFKALEESGALLESGTYDGNFYGTPKPPAE 198

  Fly   139 QSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAG 203
            .||        .||.|....|..:.....|.          |.|:.:.          |:.:...
Mouse   199 PSP--------FQPDPVDQVLFDNEFDTESQ----------RKRTTSV----------SKMERMD 235

  Fly   204 PTFPENSAQEFPSGAPASSAIDLDAMNT----CMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLG 264
            .:.||....|.......|.:::...|::    |..:.:|...||    ..|.|..:.:..:..|.
Mouse   236 SSLPEEEEDEDKEAVNGSGSMETREMHSETSDCWMKTVPSYNQT----NSSMDFRNYMMRDENLE 296

  Fly   265 ALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIA 329
            .||..||.|.|:.|.||:::|.||:|.|.|||          :.::.|..:..:.          
Mouse   297 PLPKNWEMAYTDTGMIYFIDHNTKTTTWLDPR----------LCKKAKAPEDCED---------- 341

  Fly   330 NNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDP 364
               |.||.|||:........|:::|:::.|.:.:|
Mouse   342 ---GELPYGWEKIEDPQYGTYYVDHLNQKTQFENP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 29/104 (28%)
WW 266..295 CDD:395320 14/28 (50%)
WW 335..364 CDD:395320 8/28 (29%)
Magi3NP_001152826.1 Interaction with ADRB1 and TGFA. /evidence=ECO:0000269|PubMed:15652357 18..108 6/28 (21%)
PDZ_signaling 24..103 CDD:238492 4/23 (17%)
NK 125..>199 CDD:302627 15/80 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..266 18/109 (17%)
WW 297..329 CDD:197736 17/41 (41%)
WW 345..375 CDD:238122 8/29 (28%)
Interaction with PTEN. /evidence=ECO:0000250 413..495
PDZ 416..496 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..575
PDZ 578..659 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..691
PDZ 729..812 CDD:214570
Interaction with ADGRB1. /evidence=ECO:0000250 729..811
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 818..844
PDZ_signaling 851..936 CDD:238492
Interaction with LPAR2 and GRIN2B. /evidence=ECO:0000250 852..939
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 939..966
PDZ_signaling 1023..1101 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1109..1151
MIP-T3 <1166..>1431 CDD:287245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1168..1476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.