DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and MAGI2

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_016868329.1 Gene:MAGI2 / 9863 HGNCID:18957 Length:1540 Species:Homo sapiens


Alignment Length:397 Identity:80/397 - (20%)
Similarity:133/397 - (33%) Gaps:141/397 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EDMLSPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRA 109
            ||.:...||..|:  .:...:||    :.....|.....||.|.:..:.||.:  ||.|....:.
Human   161 EDFMELEKSGALL--ESGTYEDN----YYGTPKPPAEPAPLLLNVTDQILPGA--TPSAEGKRKR 217

  Fly   110 NSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQ 174
            |.:.|..:           |||| :.|:.:               :..|..::.:....:|.|.:
Human   218 NKSVSNME-----------KASI-EPPEEE---------------EEERPVVNGNGVVVTPESSE 255

  Fly   175 QNYNVRARSDAAAANNPNANPSSQQQPAGPTF--PENSAQEFPSGAPASSAIDLDAMNTCMSQDI 237
            .    ..:|..|:...|     ||..|| |.:  ||...::.....|..            .:| 
Human   256 H----EDKSAGASGEMP-----SQPYPA-PVYSQPEELKEQMDDTKPTK------------PED- 297

  Fly   238 PMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQ 302
                                  |.:...||..||.|.|..|::|:::|.||:|.|.|||:..:.:
Human   298 ----------------------NEEPDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAK 340

  Fly   303 QQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQ 367
            .    .|..|:|:                   ||.|||:........|:::||:|.|.:.:|.::
Human   341 P----PEECKENE-------------------LPYGWEKIDDPIYGTYYVDHINRRTQFENPVLE 382

  Fly   368 S--------------GLSVLDCPDNLVSSLQIEDNLCSNLFNDAQAIVNPPS---------SHKP 409
            :              |...|..|...|.|             .:..:..|.|         |...
Human   383 AKRKLQQHNMPHTELGTKPLQAPGFRVDS-------------SSWTLPRPKSIRPRAAPERSRSV 434

  Fly   410 DDLEWYK 416
            :||.:|:
Human   435 NDLSYYQ 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 35/156 (22%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 10/28 (36%)
MAGI2XP_016868329.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.