Sequence 1: | NP_001350857.1 | Gene: | yki / 37851 | FlyBaseID: | FBgn0034970 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006516872.1 | Gene: | Hecw1 / 94253 | MGIID: | 2444115 | Length: | 1605 | Species: | Mus musculus |
Alignment Length: | 400 | Identity: | 68/400 - (17%) |
---|---|---|---|
Similarity: | 112/400 - (28%) | Gaps: | 192/400 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 SHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSS 169
Fly 170 PASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDA------ 228
Fly 229 ---MNTC--MSQDIPMS-MQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTT 287
Fly 288 KSTQWEDPRI---------------------QYRQQQQILMAERIKQNDVLQTTKQT-------- 323
Fly 324 -------------------------------------------------------------TTST 327
Fly 328 -------------------------------IANNLGPLPDGWEQAVTESGDLYFINHIDRTTSW 361
Fly 362 NDPR--MQSG 369 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yki | NP_001350857.1 | HUL4 | <261..>404 | CDD:227354 | 35/231 (15%) |
WW | 266..295 | CDD:395320 | 10/28 (36%) | ||
WW | 335..364 | CDD:395320 | 10/28 (36%) | ||
Hecw1 | XP_006516872.1 | HECW_N | 66..185 | CDD:374632 | |
C2_NEDL1-like | 206..342 | CDD:176073 | |||
Neuromodulin | 378..500 | CDD:369001 | |||
WW | 829..858 | CDD:366073 | 10/28 (36%) | ||
HECW1_helix | 947..1013 | CDD:375862 | 3/65 (5%) | ||
WW | 1019..1050 | CDD:197736 | 12/30 (40%) | ||
HECTc | 1249..1603 | CDD:238033 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |