DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Hecw1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006516872.1 Gene:Hecw1 / 94253 MGIID:2444115 Length:1605 Species:Mus musculus


Alignment Length:400 Identity:68/400 - (17%)
Similarity:112/400 - (28%) Gaps:192/400 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSS 169
            ||:|.:|.||.         .|........|.|.:.                     .:|...|.
Mouse   713 SHTRFSSVDSA---------KISESTVFSSQEDEEE---------------------ENSAFESV 747

  Fly   170 PASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDA------ 228
            |.|:|               :|..:|.| ...|||...|.:|   |.|..|.|...|::      
Mouse   748 PDSVQ---------------SPELDPES-TNGAGPWQDELAA---PGGNAARSTEGLESPMAGPS 793

  Fly   229 ---MNTC--MSQDIPMS-MQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTT 287
               ...|  :....|:| :.::..:...|..|..        .|||.||....:.|:::|::|..
Mouse   794 NRREGECPILHNSQPISQLPSLRPEHHHYPTIDE--------PLPPNWEARIDSHGRVFYVDHIN 850

  Fly   288 KSTQWEDPRI---------------------QYRQQQQILMAERIKQNDVLQTTKQT-------- 323
            ::|.|:.|.:                     :|:..|:.:..||.:::...|.::|.        
Mouse   851 RTTTWQRPSMAPTPDGMIRSGSVHQMEQLNRRYQNIQRTMATERAEEDSGNQNSEQIPDGGGGGG 915

  Fly   324 -------------------------------------------------------------TTST 327
                                                                         |:||
Mouse   916 GGSDSEAESSQSSLDLRREGSLSPVNSQKVTLLLQSPAVKFITNPEFFTVLHANYSAYRVFTSST 980

  Fly   328 -------------------------------IANNLGPLPDGWEQAVTESGDLYFINHIDRTTSW 361
                                           .|:....||.|||......|..:|::|..|.|::
Mouse   981 CLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDHQGKSFFVDHNSRATTF 1045

  Fly   362 NDPR--MQSG 369
            .|||  :|:|
Mouse  1046 IDPRIPLQNG 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 35/231 (15%)
WW 266..295 CDD:395320 10/28 (36%)
WW 335..364 CDD:395320 10/28 (36%)
Hecw1XP_006516872.1 HECW_N 66..185 CDD:374632
C2_NEDL1-like 206..342 CDD:176073
Neuromodulin 378..500 CDD:369001
WW 829..858 CDD:366073 10/28 (36%)
HECW1_helix 947..1013 CDD:375862 3/65 (5%)
WW 1019..1050 CDD:197736 12/30 (40%)
HECTc 1249..1603 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.