DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and UBE3B

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_569733.2 Gene:UBE3B / 89910 HGNCID:13478 Length:1068 Species:Homo sapiens


Alignment Length:146 Identity:27/146 - (18%)
Similarity:55/146 - (37%) Gaps:39/146 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQT--TTSTIANNLGPLPDGWEQA 342
            ::.|:.|:::  |...|.:..::::::..||.:...|:|...::  ..|.:..::.         
Human     1 MFTLSQTSRA--WFIDRARQAREERLVQKERERAAVVIQAHVRSFLCRSRLQRDIR--------- 54

  Fly   343 VTESGDLYFINHIDRTTSWNDPR--MQSGLSVLDCPDNLVSSLQI-EDN-----LCSNLFNDAQA 399
                      ..||.....:||.  .:|.|.:......|:...:| |||     ||.::.:...|
Human    55 ----------REIDDFFKADDPESTKRSALCIFKIARKLLFLFRIKEDNERFEKLCRSILSSMDA 109

  Fly   400 IVNPPSSHKPDDLEWY 415
             .|.|.       .||
Human   110 -ENEPK-------VWY 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 24/133 (18%)
WW 266..295 CDD:395320 3/14 (21%)
WW 335..364 CDD:395320 2/28 (7%)
UBE3BNP_569733.2 HECTc 682..1066 CDD:238033
HECTc 707..1065 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.