DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and HERC3

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_055421.1 Gene:HERC3 / 8916 HGNCID:4876 Length:1050 Species:Homo sapiens


Alignment Length:404 Identity:66/404 - (16%)
Similarity:121/404 - (29%) Gaps:137/404 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 HSRANSADS---TYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHS---------- 157
            |..|.:||.   |:...|...:.:|.:......|.....:..||..|:.....||          
Human   148 HCLALAADGQFFTWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHSFALSLSGAVF 212

  Fly   158 --------RLAIHHSRARSSPASL--------------QQNYNVRARSDAA-------------A 187
                    :|.:...:.|.||..:              :::..|..:|...             .
Human   213 GWGMNNAGQLGLSDEKDRESPCHVKLLRTQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHD 277

  Fly   188 ANNPNANPSSQQQPAGPTFPENSA--QEFPSGAPASSAI---------DLDAMNTCMSQDIPMSM 241
            :.|...||....:..|....:.:.  |...:..|:|..|         .|...:|| :...|..:
Human   278 SMNDEVNPRRVLELMGSEVTQIACGRQHTLAFVPSSGLIYAFGCGARGQLGTGHTC-NVKCPSPV 341

  Fly   242 Q---TVHKKQRS-------YDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWED-- 294
            :   ..|..|.|       |.::                :|..:...|.:.|     .:::|:  
Human   342 KGYWAAHSGQLSARADRFKYHIV----------------KQIFSGGDQTFVL-----CSKYENYS 385

  Fly   295 PRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTT 359
            |.:.:|...|......|  ||          .|||        .|.|.::|..:...||.:.:..
Human   386 PAVDFRTMNQAHYTSLI--ND----------ETIA--------VWRQKLSEHNNANTINGVVQIL 430

  Fly   360 S----WN--------DPRMQSGLSVLDCPDNLVSSLQI---------EDNLCSNLFNDAQAIVNP 403
            |    ||        |...::...:   |...::|.::         ...:...:.|..::.:.|
Human   431 SSAACWNGSFLEKKIDEHFKTSPKI---PGIDLNSTRVLFEKLMNSQHSMILEQILNSFESCLIP 492

  Fly   404 PSSHKPDDLEWYKI 417
            ..|..|.|:|..:|
Human   493 QLSSSPPDVEAMRI 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 25/165 (15%)
WW 266..295 CDD:395320 4/30 (13%)
WW 335..364 CDD:395320 8/40 (20%)
HERC3NP_055421.1 RCC1 1 1..51
ATS1 2..331 CDD:227511 28/182 (15%)
RCC1 2 52..101
RCC1 3 102..154 2/5 (40%)
RCC1 4 156..207 9/50 (18%)
RCC1 5 208..259 5/50 (10%)
RCC1 6 261..311 5/49 (10%)
RCC1 313..377 CDD:366085 12/80 (15%)
RCC1 7 313..366 10/69 (14%)
HECTc 702..1048 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.