DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and UFD4

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_012915.3 Gene:UFD4 / 853859 SGDID:S000001493 Length:1483 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:39/198 - (19%)
Similarity:69/198 - (34%) Gaps:56/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CLIAKIILCSFRLYTISA------FYMLTTMSASSNTNSLIEKEIDDEDMLSPIKSNNLVVRVNQ 62
            |||..::    .:||.:|      :.::..:...|..|:...|.|:|: ::..|.|    :...:
Yeast   510 CLIPILV----EIYTNAADFDVRRYVLIALLRVVSCINNSTAKAINDQ-LIKLIGS----ILAQK 565

  Fly    63 DTDDNLQALFDS---VLNPGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRANSADSTYDAGSQSSI 124
            :|..|....:.|   .|..|...   .|.|..:|....||    ||..|    :..:|.....|:
Yeast   566 ETASNANGTYSSEAGTLLVGGLS---LLDLICKKFSELFF----PSIKR----EGIFDLVKDLSV 619

  Fly   125 NIGNKASIVQQPDGQSPIA------------------------AIPQLQIQPSPQHSRLAIHHSR 165
            :..|   |..:.||...|:                        ....::|..|.:..:::||..|
Yeast   620 DFNN---IDLKEDGNENISLSDEEGDLHSSIEECDEGDEEYDYEFTDMEIPDSVKPKKISIHIFR 681

  Fly   166 ARS 168
            ..|
Yeast   682 TLS 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354
WW 266..295 CDD:395320
WW 335..364 CDD:395320
UFD4NP_012915.3 HUL4 581..1482 CDD:227354 23/118 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.