DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and HUL5

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_011374.1 Gene:HUL5 / 852736 SGDID:S000003109 Length:910 Species:Saccharomyces cerevisiae


Alignment Length:201 Identity:33/201 - (16%)
Similarity:65/201 - (32%) Gaps:64/201 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 RSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQY--------RQQQQI 305
            |.|..:...:.|..|....|...:....|.::::|:.....|.||:...|:        .|:.:.
Yeast   389 RQYWELPKSERNPMLKEAVPLLSKVYERDSRLHFLSTENNPTYWENSEKQFLNLRFYEELQEYED 453

  Fly   306 LMAERIKQ---NDV-----LQTTKQTTTSTIANNLG------------------PLPDGWEQAVT 344
            |..|.:::   .|:     |...:....|.:.|.:.                  |....:|:.| 
Yeast   454 LYREHLEEESDEDMEKEIDLDKERPPLKSLLLNKMKKRLKSSLRFRKLEILLELPFFIPFEERV- 517

  Fly   345 ESGDLYFI---------------NHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLCSNLF 394
               ||:::               |.|:..|.|....|:...:::.           .||:..:.|
Yeast   518 ---DLFYMFIALDKKRLSLDDDHNLINMFTPWASTGMRKQSAIIS-----------RDNVLEDAF 568

  Fly   395 NDAQAI 400
            |...:|
Yeast   569 NAFNSI 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 30/189 (16%)
WW 266..295 CDD:395320 6/28 (21%)
WW 335..364 CDD:395320 8/43 (19%)
HUL5NP_011374.1 HUL4 35..910 CDD:227354 33/201 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.